PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04954.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6796.87 Da    PI: 11.17
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04954.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF961.7e-301059251
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  ri+n++ rqvtfskRrngi+KKA ELS+LCdaev ++ifsstg+lyey+s
  Zpz_sc04954.1.g00010.1.sm.mk 10 RIDNSTSRQVTFSKRRNGIFKKARELSILCDAEVGLVIFSSTGRLYEYAS 59
                                  8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.903160IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-40160IPR002100Transcription factor, MADS-box
CDDcd002656.16E-37260No hitNo description
SuperFamilySSF554558.37E-29259IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KARELSILCD AEVGLVIFSS TGRLYEYAST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-20160160Myocyte-specific enhancer factor 2B
1tqe_R4e-20160160Myocyte-specific enhancer factor 2B
1tqe_Q4e-20160160Myocyte-specific enhancer factor 2B
1tqe_P4e-20160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283384e-57KJ728338.1 Zea mays clone pUT6619 MADS transcription factor (MADS63) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446622.11e-35hypothetical protein SORBIDRAFT_06g019040
SwissprotQ6Z6W21e-34MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A060D8X14e-36A0A060D8X1_MAIZE; MADS transcription factor (Fragment)
STRINGGRMZM2G032905_P011e-35(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.17e-34AGAMOUS-like 44